PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 371aa    MW: 41628.2 Da    PI: 4.4328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08650.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l+++++  G g+W++ ++  g+ R++k+c++rw +yl
       KHN08650.1 14 KGRWTAEEDEILAKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.11.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE+  +v++++ +G++ W++Ia++++ gRt++++k++w+++l
       KHN08650.1  67 RGNISAEEENTIVKLHASFGNR-WSLIANHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.026961IPR017930Myb domain
SuperFamilySSF466898.07E-2811108IPR009057Homeodomain-like
SMARTSM007175.3E-121363IPR001005SANT/Myb domain
PfamPF002497.5E-151461IPR001005SANT/Myb domain
CDDcd001672.47E-81661No hitNo description
PROSITE profilePS5129425.69962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2565116IPR009057Homeodomain-like
SMARTSM007172.3E-1666114IPR001005SANT/Myb domain
PfamPF002496.7E-1567112IPR001005SANT/Myb domain
CDDcd001679.27E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDEILAKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SAEEENTIVK LHASFGNRWS LIANHLPGRT DNEIKNYWNS HLSRKIYSFP  120
GAGAGASAGI MDTPKVVYIP PKRKCGRTSR WAMKKNKTYT QKVNDRINQR HTQIGFPQQN  180
SDTAVPTPPT PSLESEGLSN AVNDFKVLDG DVAEFDEPRT EELEAEVNKR DNSVGGVEES  240
SNTDEDILGL CELEGINEDS GMLLGFSDIL ESCLAETTCG VWDISEERES NDVVAADACR  300
DKIASSEEGS CSSMNQDWDW ESVLEFSNAV DNWEDQDKLL TWLWEDDDCK RLGETDTQIL  360
QNDMVIDWFL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-22121162105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-221211656159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-221211656159MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-221211625128MYB TRANSFORMING PROTEIN
1mse_C1e-22121162105C-Myb DNA-Binding Domain
1msf_C1e-22121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0934630.0BT093463.1 Soybean clone JCVI-FLGm-17G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006574536.10.0PREDICTED: transcription factor MYB12-like
TrEMBLA0A0B2PHF50.0A0A0B2PHF5_GLYSO; Transcription factor MYB12
TrEMBLI1JBH50.0I1JBH5_SOYBN; Uncharacterized protein
STRINGGLYMA02G01740.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.19e-77myb domain protein 12
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]